- Fixed:
= Build issue with
hypertookkitinstall.shscript- Was failing on
trixiedue to issues handlingtriie-backportsrepo
- Was failing on
install.shwasn't showing CLI options with-h/--help- Verified
update.shfollows this fix and added more defensive code
- Updated:
- Hyprland v0.55.4
- Aquamarine v12.1
- Wayland Protocols v1.49
- Wayland Scanner v1.25
- Re-ordered build sequence to build Wayland scanner before Wayland Protocols\
- Issue with QT variables that prevented apps like KDENLINE from running
- Added qml6-module-org-hyprland-style to Debian package-mode optional install list.
- Added it to purge list used when removing Debian Hyprland packages.
- update-hyprland.sh
- Added qml6-module-org-hyprland-style to Debian package-mode optional install list.
- Added it to package cleanup/purge list.
- install-scripts/02-pre-cleanup.sh
- Added qml6-module-org-hyprland-style to uninstall list.
- For trixie if pkg not found check
trixie-backports - Run:
install-scripts/update-deps.sh
- Installer for
yaziand myyazicfg files- Wired in the
yaziinstaller into install and check process - Updated to new repo with debian/ubuntu specific versions
- Also check for static binaries in
/usr/local/binand removes them
- Wired in the
- New depdencies to fix build errors in
Trixie - Debian version package awareness to ``00-depdencies.sh`
- Stops failed install errors as I tried to install all versions of some pkgs
- This framework will allow future pkg issues to be quickly resolved
install-scripts/update-deps.sh- Updates packages w/o having to re-install everything
- Needed for LUA migration
- Missing depdendencies for Hyprland v0.55.0
- New dependencies for LUA
socatforTak0 scripts
-
Not all scripts used
#!/usr/bin/env bash -
Some scritps not executable
-
LUA pkg name in trixie, fixinng installation failure errors
-
hardcode username is
hyprtoolkit -
Fixed compile issue
hyprtoolkit -
auto-install.sh- The script would got a git pull if Distro-Hyprland directory exsited
- If user started with JakooLit installer it would not get updated code
- Changed to remove
Distro-Hyprlandand do fresh git clone
-
Updated:
- Hyprland build to v0.55.2
hyprpicker
-
Ported fix for hyprsysteminfo from
lua-cfg-testbranch- The
#embedpolyfill: - Added the fallback script that checks for missing
#embed - support on older toolchains and uses xxd + awk to convert the hyprlandlogo.svg
- to an inline bytes header (hyprlandlogo.bytes.inc).
- C++ standard library linkage (extern "C"): Added the perl snippet to wrap
#include <pci/pci.h>withextern "C"inSystemInfo.cppso it links correctly.- PCI dependencies and linker flags: Added
libpci-devto the install check loop - (re_install_package) and injected
-lpcilinker flags across the CMake configuration.
- The
-
Downloaded
libasl-dev- Causes ABI version mismatch build failure
apt-mark holdset also
-
Also set whiptail to dark contrasting colors
- Previous version often left menu unreadable
- Will do same for the other installers
-
Fixed some scripts changing ownership of files/directories
-
Fixed build script for
hyprsysteminfo- Needed
qt6 WaylandClientPrivate
- Needed
-
Fixed build script for
hyprsysteminfo- Needed
qt6 WaylandClientPrivate
- Needed
-
Fixed bad substitusion in
install.shscript -
Fixed
install-ags.sh- Debian Trixie has old version of
tsc - Removed it from apt depdendencies added it with
npm
- Debian Trixie has old version of
-
Fixed preflight depdendencies check during install
- It was called before the pkgs were installed
-
Fixed long standing bug in fastfetch copy
- The
install.shscript was overwrittingconfig.jsonc
- The
-
Updated:
- Install script to support
deb822format - Documentation and screen prompts to reflect this change
- Install script to support
-
Update
hyprlocktov0.9.5 -
Fixed issues install with debian packages
- Fixed several "failed to install package" errors
-
Fixed polkit issues
- Added missing QT kvantum packages
- This prevented the escalation dialog from running
sudo apt install libqt5quick5 libqt5qml5 qt6-declarative-dev
-
Improved: Error handling in the
install.shscript- Thank you
@moukhtar22for finding this and filing an issue
- Thank you
-
Removed invalid QT packages
- Thank you
@moukhtar22for finding this and filing an issue
- Thank you
-
Fixed
ags.shscript- Failed to build
-
Fixed library conflict when using debian pkgs after building from source
- Updated script to remove them
-
Fixed refresh tags script
-
Updated
hyprutils -
Added
hyprshutdown- Need to implement in HL dots it more gracefully terminals apps
-
Added menu option to build from source (recommended) or debian pkgs
- Currently Debian has HL v0.54.3 no iden when/if they will update it
- Source builds can keep up to date
- You can switch from debian package to source and vice-versa with
install.shscript
-
Fixed
ags.shinstall script -
Added option to build Hyprland from deb packages
- Faster install
- Potentially more stable
- Won't be updated as often
update-hyprland.shcan switch between source and pkgs
-
Updated output format of the output of
update-hyprland.sh -
Fixed wallpaper issue
-
Switching to Hyprland package build left behind source built binaries
- Caused hyprland to crash at startup with missing library
-
Fixed
refresh-tags.sh- Wasn't updating properly
- Added fallback to
git ls-remote- For 403/404 errors
- Also fixed repeating 403/404 errors
- Added option for GitHub token to avoid rate limits
- Added
wayland-protocolsto hyprland tags- It wasn't getting updated and was three revs behind
-
Fixed
refresh-tags.sh- Wasn't updating properly
- Added fallback to
git ls-remote- For 403/404 errors
- Also fixed repeating 403/404 errors
- Added option for GitHub token to avoid rate limits
- Added
wayland-protocolsto hyprland tags- It wasn't getting updated and was three revs behind
- Major refactor of Hyprland build process
- Thanks to
@Bombatomica64- Updates the Debian Hyprland stack installer scripts to better support Hyprland v0.54+
- Changes:
- Add orphaned-file cleanup with preview + confirmation and
- Introduce a
--cleanflag inupdate-hyprland.sh. - Standardize multiple module install prefixes to
/usr/local(CMake+Meson). - Add
Clang 21installation viaLLVMAPT repo (signed-by keyring) - Set prference to
clang-21in the Hyprland build.
- Thanks to
- Fixed issues with policy kit
- Which prevented permission esclation
- Added
mate polkitas backup - Added
gnome-polkitas primary- Found corner cases where it otherwise failed
- Added missing
kvantumpackages breakingkde polkit
- Updated Hyprland tags
- Hyprland v0.54.3
- Added
ldconfig path detectionin00-dependencies.shto avoid false libGL cache failures when /usr/sbin isn’t in PATH - Updated
update-hyprland.shto includehyprcursorin default module order and Hyprland prerequisite checks (ensures it builds before Hyprland) - Added
hyprcursor to the default dry-run stack indry-run-build.sh - Modified
hyprshutdownto fetch its bundled Glaze version to avoid system Glaze API mismatches
- Updated build tags to Hyprland v0.54.2
- Added presence and version check for rofi
- To prevent removal and re-install when rofi was built from source
- Updated build tags to Hyprland v0.54.1
- Added colored status results when buildng Hyprland
- Added additional checks in
00-depdendencies.sh- Recent custom debian distro had mixed testing/forky repos
- Caused issues building Hyprland b/c of QT/OpenGL libs and missing headers
- If checks find issues preventing build completion, the script will exit
- It will display an error and suggested course of action
- Fixed
update-hyprlandscript to properly build Hyprland v0.54
- Enhanced Hyprland debian package cleanup in
install.sh- Some Hyprland packages weren't getting removed
- Added
--pacakge-cleanupoption toupdate-hyprland.sh- Source building is the supported method because:
- deb packages could be removed from testing/unstable at anytime w/o notice
- The packages might not updated for some time
- Not currently available for debian 13 stable branch
- Source building is the supported method because:
- Updated documentation
- Updated Discord Link
- Removed JakooLit ko-fi, wallet, etc
- Removed stargazer star graph
- Updated
uninstall.shto remove compiled pkgs as well as deb pkgs - Updated hyprwire to v0.3.0
- Moved hyprland dependencies to 00-dependencies script
- Added additional check for build tools before starting compile
-
Added/Updated:
hyprsunsethyprsysteminfohyprlockhypridlehyprshutdownhyprpickerhyprpwcemterhyprtavernhyprwirehyprwire-protocolshyprlauncherhyprpaper
-
Fixed build issues for
trixie.testingandunstable -
Added additional required pacakges to install script
-
Fixed duplicates in
aptsources -
Enable
deb-srcif not already enabled -
Added fallback for
gtk2-engines-murrine
- Improved
nvidia.shscript- Checks for current kernel headers
- Improved menu with help
install.shchecks for deb source and non-free repos
- Improved
install.sh- Removed installing pkgs then build from source later
- Removed
wayland-protocolpkg install since we build from source - Removed forced re-install of imagick
- Not sure why that was there but added --force-reinstall flag in case
- Updated
rofito v2.00- Supports X11 and Wayland
- Added path and version checks:
- wallust
- swww
- Both were compiled on every run of
install.sh
- Both were compiled on every run of
- Removed XDG Hyprland portal from insall menu, it's installed by default
- Added
-ttyfallback menu toinstall.shto bypass whiptail - Added
-h/--helptoinstall.sh - Fixed
weztermcrashing in Hyprland.- The meson build script was missing two library paths
- Causing wezterm to panic on startup
- Made open source driver for NVIDIA the default option
- Open source is required for current gen cards
- It works better than propriertary
- Lowers CPU overhead with GSP enhancements
- Improved messaging in the script and in
HOWTO-Install-NVIDIA-Drivers-in-Debian.mddoc - Created Spanish translation of
HOWTO-Install-NVIDIA-Drivers-in-Debian.es.md
- Updated
nvidia.sh- Options to install:
- Debian drivers (older NVIDIA GPUs)
- For more recent NVIDIA GPUs
- NVIDIA propriertary drivers
- NVIDIA open drivers
- You can switch between them later
- Read
HOWTO-Install-NVIDIA-Drivers-in-Debian.md
- Options to install:
- Updated Hyprland to current revision
- AQUAMARINE_TAG=v0.10.0
- HYPRGRAPHICS_TAG=v0.5.0
- HYPRLAND_GUIUTILS_TAG=v0.2.1
- HYPRLAND_PROTOCOLS_TAG=v0.7.0
- HYPRLAND_QT_SUPPORT_TAG=v0.1.0
- HYPRLAND_QTUTILS_TAG=v0.1.5
- HYPRLAND_TAG=v0.53.3
- HYPRLANG_TAG=v0.6.8
- HYPRTOOLKIT_TAG=v0.5.3
- HYPRUTILS_TAG=v0.11.0
- HYPRWAYLAND_SCANNER_TAG=v0.4.5
- HYPRWIRE_TAG=v0.3.0
- WAYLAND_PROTOCOLS_TAG=1.46
- Updated
uninstall.shto remove source built binaries - Fixed build issues with Debian Trixie
- Fixed installation path handling
- Removed old code related to debian packages for Hyprland
- All references to
Nix::,Nix.hpp,Nix.cpp,--no-nixgl, andnixGLin the built Hyprland sources are removed via assets/0002-start-hyprland-no-nixgl.patch. - The patch:
- Drops the Nix include and logic from
start/src/core/Instance.cpp,start/src/core/State.hpp, andstart/src/main.cpp. - Removes the
--no-nixglflag and the Nix environment checks. - Now
start-hyprlandstartsHyprlanddirectly, with nonixGLwrapper or Nix environment inspection.
- Drops the Nix include and logic from
- Updated Hyprland version to v0.53.3
- Fixes
hyprpmissues - All other packages remain at the same version
- New layout for building Hyprland Source
- The
builddirectory will hold the source and compiler output - Now you can just remove the build directory after install
- The
- Updated the default Hyprland version to
v0.53.2 - Updated the documentation on the new directory layout
- Fixed issue of Fastfetch reading old hyprland version file
- If you later upgrade Debian to
ForkyorSIDyou MUST recompile Hyprland!!- Run
update-hyprland --install --with-deps - Reboot after
- Failure to do so will prevent Hyprland from starting
- You will be returned to the login manager
- Run
- Updated README
- Added not about not supporting
KaliLinux - Update info on NVIDIA GPUs
- Cleaning up some formatting
- Added not about not supporting
- Updated:
- Default Hyprland stack versions now target 0.53.2 (see
hypr-tags.env) - Added trixie compatibility mode flags:
--build-trixie/--no-trixie(auto-detected on Debian 13)
- Added
--force-updateto refresh pinned package versions update-hyprland.shadded-/--help- Documentation for updating hyprland
- Default Hyprland stack versions now target 0.53.2 (see
- Added:
- Version refresh improvements for
refresh-hypr-tags.sh(accepts--get-latest, retries transient GitHub errors)
- Version refresh improvements for
- Fixed:
--force-updateimplies--fetch-latest
- Updated:
- Hyprland Build to v0.52.2
- Thanks entirely to @sdegler
- Fixed:
qt5-style-kvantum-themesfailed to install- Wrong package name it's
qt-style-kvantume-themes
- Wrong package name it's
libdisplay-info2failed to install- New package name:
libdisplay-info3
- New package name:
-
Hyprland builds 0.51.x from source -
Added documentation for upgrading from 0.49/0.50.x to 0.51.1.
- update-hyprland.sh: Manage the Hyprland stack with:
- --install / --dry-run build modes
- --only and --skip for selective components
- --with-deps to (re)install build deps
- --set {KEY=TAG} and --restore tag backup support
- --fetch-latest to pull latest GitHub release tags
- --via-helper to delegate summary-only dry-runs
- dry-run-build.sh: Compile-only helper with summary output
- install-scripts/wayland-protocols-src.sh: Build wayland-protocols from
source (>= 1.45) to satisfy Hyprland 0.51.x requirements
- Centralized tag management via hypr-tags.env; tags exported to all
modules. Environment overrides remain first priority.
- Automatic dependency ordering for Hyprland 0.51.x:
wayland-protocols-src → hyprland-protocols → hyprutils → hyprlang →
aquamarine → hyprland
- Optional auto-fetch of latest tags on install runs that include
hyprland (can be disabled via --no-fetch)
- Selective updates for targeted components and skip lists
- Dry-run mode to validate builds without installing
- install.sh reads hypr-tags.env and optionally refreshes tags.
- Ensures wayland-protocols-src is built before Hyprland.
- Maintains proper sequencing for the Hyprland dependencies.
- Debian-Hyprland-Install-Upgrade.md and .es.md:
- Add explicit section: Upgrade 0.49/0.50.x → 0.51.1
- Recommend: `./update-hyprland.sh --install --only hyprland`
- Provide optional `--with-deps` and `--dry-run` flows
- Full install via install.sh is not required for this
upgrade unless optional modules need refresh
- Pin and upgrade to 0.51.1:
./update-hyprland.sh --set HYPRLAND=v0.51.1
./update-hyprland.sh --install --only hyprland
- Optional:
./update-hyprland.sh --with-deps --install --only hyprland
./update-hyprland.sh --dry-run --only hyprland
- Target OS remains Debian Trixie/Testing/SID
- Run as sudo-capable user (not root)
- Ensure deb-src entries are enabled.
- Updated sddm theme and script to work with the updated simple_sddm_2 theme
- Manual building process
- Added a warning message that support is now very limited
- updated SDDM theme.
- added findutils as dependencies
- Added uninstall script
- forked AGS v1 into JakooLit repo. This is just incase Aylur decide to take down v1
- Dropped pyprland in favor of hyprland built in tool for a drop down like terminal and Desktop magnifier
- Switched to whiptail version for Y & N questions
- switched eza to lsd
- added Victor Mono Font for proper hyprlock font rendering for Dots v2.3.12
- added Fantasque Sans Mono Nerd for Kitty
- replaced eog with loupe
- changed url for installing oh-my-zsh to get wider coverage. Some countries are blocking github raw url's
- Change default zsh theme to adnosterzak
- pokemon coloscript integrated with fastfetch when opted with pokemon to add some bling
- additional external oh-my-zsh theme
- added semi-unattended function.
- move all the initial questions at the beginning
- Re-coded for better visibility
- Offered a new SDDM theme.
- script will automatically detect if you have nvidia but script still offer if you want to set up for user
- AGS (aylur's GTK shell) v1 for desktop overview is now optional
- switch to final version of aylurs-gtk-shell-v1
- Switched to download dots from KooL's Hyprland dots specific branch
- Removal of Bibata Ice cursor on assets since its integrated in the GTK Themes and Icons extract from a separate repo
- updated swww.sh to download from version v0.9.5
- switched to download rofi-wayland from releases instead from upstream
- User will be ask if they want to set Thunar as default file manager if they decided to install it
- updated xdph installation since it is now in Debian Repo
- Added fastfetch on tty. However, will be disabled if user decided to install pokemon colorscripts
- Added Essential Packages final check in lieu of errors from Install log files in Install-Logs directory
- nwg-look is now in Debian Repo
- added background check of known login managers if they are active if user chose to install sddm
- Added final error checks on install-logs
- Fix installation issue on hyprlock and xdph
- disabled imagemagick compilation from source
- dotfiles adjusted so it will be compatible for imagemagick v6
- added a function to check if it is Ubuntu or Based on Ubuntu and script will exit
- Added final check if hyprland is installed and will give an error to user
- Created a newer and compatible Hyprland-Dots repo
- Moved Ubuntu-Hyprland on a separate Github Repo
- refactor Debian-Hyprland script. As Hyprland is now in official repo
- added eza (ls replacement for tty). Note only on .zshrc
- Version bumps for Debian (Hyprland v0.41.2)
- adjusted script to install only Hyprland-Dots v2.2.14
- changed behaviour of rofi-wayland.sh. To redownload a new rofi-wayland from repo instead of pulling changes. (It proves giving issue)
- switched over to source install for imagemagick
- removal of fzf for Debian and Ubuntu (headache)
- Added fzf for zsh (CTRL R to invoke FZF history)
- added qalculate-gtk to work with rofi-calc. Default keybinds (SUPER ALT C)
- added power-profiles-daemon for ROG laptops. Note, I cant add to all since it conflicts with TLP, CPU-Auto-frequency etc.
- Note: Fastfetch configs will be added from Hyprland-Dots v2.2.12. However, you need to install from Fastfetch github page
- Disabled the auto-login in .zprofile as it causes auto-login to Hyprland if any wayland was chosen. Can enabled if only using hyprland
- Backed down hyprland version to install as v0.40.0 is failing to install
- removed from waybar-git to install. Instead to install from official repo
- cliphist install script is removed as it is now on Debian repo
- dependencies cleaned up and added
- added wallust-git and remove python-pywal for migration to wallust on Hyprland-Dots v2.2.11
- added ags.sh for upcoming ags overview for next Hyprland-Dots release. Will be installed form source
- added manual installation of waybar since Debian is very slow in updating their packages
- Bump swww to v0.9.5
- added python3-pyquery for new weather-waybar python based on Hyprland-Dots
- Added pyprland (hyprland plugin) - warning, I cant make it to properly run. Drop Down terminal not working, zoom is hit and miss
- Updated hyprland.sh to install v0.39.1 Hyprland
- adding hypridle and hyprlock
- dropping swaylock-effects and swayidle
- adjusted to work with current Hyprland-Dots
- Change dotfiles to specific version only as Debian and Ubuntu cant keep up with Hyprland development
- Change default Oh-my-zsh theme to xiong-chiamiov-plus
- dropped wlsunset
- added hyprlang build and install
- Readme updated for cliphist instruction for ubuntu 23.10 users
- Created cliphist.sh for ubuntu 23.10 users (disabled by default and needs to be enabled on install.sh if desired)
- Code Cleaned up.
- Pokemon Color Scripts now offered as optional
- Remove dunst in favor of swaync. NOTE: Part of the script is to also uninstall mako and dunst (if installed) as on my experience, dunst is sometimes taking over the notification even if it is not set to start
- zsh theme switched to
agnostertheme by default - pywal tty color change disabled by default
- Added a script / function to force install packages. Some users reported that it is not installed.
- Changing over to zsh automatically if user opted
- If chose to install zsh and have no login manager, zsh auto login will auto start Hyprland
- added as optional, with zsh, pokemon colorscripts
- improved zsh install scripts, so even the existing zsh users of can still opt for zsh and oh-my-zsh installation :)
- Added kvantum for qt apps theming
- return of wlogout due to theming issues of rofi-power
- replace the Hyprland to specific branch/version as newest needed some new libraries and debian dont have those yet
- nvidia - Move to normal hyprland package as nvidia patches are doing nothing see
commit
- drop wlogout since Hyprland-Dots v2.1.9 uses rofi-power
- Added Bibata cursor to install if opted for GTK Themes. However, it is not pre-applied. Use nwg-look utility to apply
- Adjust dotfiles script to download from releases instead of from upstream
- initial release. Added swappy for screenshots
- BETA release